BindingDB PrimarySearch

Found 1 Enz. Inhib. hit(s) with Target = 'Activin receptor type-2A' and Ligand = 'BDBM50557755'

Activin receptor type-2A(Homo sapiens (Human))TBA

BDBM50557755(CHEMBL4782729)copy SMILES

IC50: 2.90E+3nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair

PDB MMDB Reactome pathway KEGG
UniProtKB/SwissProt
B.MOAD antibodypedia GoogleScholar

PC cid PC sid

Details Article
BindingDB Entry DOI: 10.7270/Q2PG1WD5PubMed