BDBM50441587 CHEMBL2437157

SMILES: O=C(Cc1ccc(cc1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1

InChI Key: InChIKey=ASVLCJFACSELPH-UHFFFAOYSA-N

Data: 2 IC50

Find this compound or compounds like it in BindingDB or PDB:

Substructure Similarity at least:  must be >=0.5 Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 2 hits for monomerid = 50441587   

Target/Host (Institution)	Ligand	Target/Host Links	Ligand Links	Trg + Lig Links	Ki nM	ΔG° kcal/mole	IC50 nM	Kd nM	EC50/IC50 nM	koff s-1	kon M-1s-1	pH	Temp °C
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5) (Homo sapiens (Human))	BDBM50441587 (CHEMBL2437157) Show SMILES O=C(Cc1ccc(cc1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C25H33N3OS/c29-24(19-21-14-16-23(17-15-21)22-12-5-2-6-13-22)27-28-25(30)26-18-8-7-11-20-9-3-1-4-10-20/h2,5-6,12-17,20H,1,3-4,7-11,18-19H2,(H,27,29)(H2,26,28,30)	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem	Article PubMed	n/a	n/a	300	n/a	n/a	n/a	n/a	n/a	n/a
INSERM Curated by ChEMBL					Assay Description Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...				Eur J Med Chem 69: 244-61 (2013) Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM
					More data for this Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4) (Homo sapiens (Human))	BDBM50441587 (CHEMBL2437157) Show SMILES O=C(Cc1ccc(cc1)-c1ccccc1)NNC(=S)NCCCCC1CCCCC1 Show InChI InChI=1S/C25H33N3OS/c29-24(19-21-14-16-23(17-15-21)22-12-5-2-6-13-22)27-28-25(30)26-18-8-7-11-20-9-3-1-4-10-20/h2,5-6,12-17,20H,1,3-4,7-11,18-19H2,(H,27,29)(H2,26,28,30)	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	CHEMBL PC cid PC sid UniChem	Article PubMed	n/a	n/a	730	n/a	n/a	n/a	n/a	n/a	n/a
INSERM Curated by ChEMBL					Assay Description Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...				Eur J Med Chem 69: 244-61 (2013) Article DOI: 10.1016/j.ejmech.2013.08.027 BindingDB Entry DOI: 10.7270/Q2J967TM
					More data for this Ligand-Target Pair