Target/Host (Institution) | Ligand | Target/Host Links | Ligand Links | Trg + Lig Links | Ki nM | ΔG° kJ/mole | IC50 nM | Kd nM | EC50/IC50 nM | koff s-1 | kon M-1s-1 | pH | Temp °C |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM21 (CHEMBL24828 | N-(4-bromo-2-fluorophenyl)-6-methoxy...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE PC cid PC sid PDB UniChem Similars | PCBioAssay | n/a | n/a | n/a | 50 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM21079 (1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 110 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50368452 (CHEMBL4168305) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase PC cid PC sid PDB UniChem Similars | Article PubMed | n/a | n/a | n/a | 200 | n/a | n/a | n/a | n/a | n/a |
Jinan University Curated by ChEMBL | Assay Description Binding affinity to human EPHA7 | J Med Chem 61: 7977-7990 (2018) Article DOI: 10.1021/acs.jmedchem.8b01045 BindingDB Entry DOI: 10.7270/Q24Q7XHN | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM4779 (CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 270 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31096 (CHEMBL290084 | Staurosporine | cid_451705) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 290 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM21079 (1-[4-(3-amino-1H-indazol-4-yl)phenyl]-3-(2-fluoro-...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 330 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM16673 (4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamo...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 370 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31085 (1-[4-[(4-ethyl-1-piperazinyl)methyl]-3-(trifluorom...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem Similars | PCBioAssay | n/a | n/a | n/a | 380 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM5446 (CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | ...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 440 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM24773 (AMG 706 | AMG-706 | Motesanib | N-(3,3-dimethyl-1,...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 490 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31093 (4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-py...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 580 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM5447 (CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-flu...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 590 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31096 (CHEMBL290084 | Staurosporine | cid_451705) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 630 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50505541 (CHEMBL4465866) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | Article PubMed | n/a | n/a | n/a | 766 | n/a | n/a | n/a | n/a | n/a |
Takeda Pharmaceutical Company Limited Curated by ChEMBL | Assay Description Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in... | Bioorg Med Chem Lett 29: (2019) Article DOI: 10.1016/j.bmcl.2019.126641 BindingDB Entry DOI: 10.7270/Q2RV0S0K | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM13533 (1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 860 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50505542 (CHEMBL4576489) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | Article PubMed | n/a | n/a | n/a | 887 | n/a | n/a | n/a | n/a | n/a |
Takeda Pharmaceutical Company Limited Curated by ChEMBL | Assay Description Binding affinity to recombinant N-terminal His-FLAG-GST-tagged EPHA7 (unknown origin) ( 595 to 998 residues) expressed in baculovirus infected Sf9 in... | Bioorg Med Chem Lett 29: (2019) Article DOI: 10.1016/j.bmcl.2019.126641 BindingDB Entry DOI: 10.7270/Q2RV0S0K | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM4814 (CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fl...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 960 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31093 (4-[[7-[2,6-bis(fluoranyl)phenyl]-9-chloranyl-5H-py...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 1.00E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31085 (1-[4-[(4-ethyl-1-piperazinyl)methyl]-3-(trifluorom...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem Similars | PCBioAssay | n/a | n/a | n/a | 1.10E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM13336 (4-[4-(4-fluorophenyl)-2-(4-methanesulfinylphenyl)-...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 1.20E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM5446 (CHEMBL553 | ERLOTINIB HYDROCHLORIDE | Erlotinib | ...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 1.40E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31088 (1-methyl-5-[2-[5-(trifluoromethyl)-1H-imidazol-2-y...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 1.50E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM31095 (5-[(Z)-(5-fluoranyl-2-oxidanylidene-1H-indol-3-yli...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 2.00E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM13533 (1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 2.00E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM13531 (4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridy...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase PC cid PC sid UniChem Similars | PCBioAssay | n/a | n/a | n/a | 2.20E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM21 (CHEMBL24828 | N-(4-bromo-2-fluorophenyl)-6-methoxy...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE PC cid PC sid PDB UniChem Similars | PCBioAssay | n/a | n/a | n/a | 2.40E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM4814 (CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fl...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 2.40E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM6866 (1-Acyl-1H-[1,2,4]triazole-3,5-diamine Analogue 3b ...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 3.10E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM16673 (4-[4-({[4-chloro-3-(trifluoromethyl)phenyl]carbamo...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | PCBioAssay | n/a | n/a | n/a | 5.30E+3 | n/a | n/a | n/a | 7.4 | 25 |
Ambit Biosciences Curated by PubChem BioAssay | Assay Description Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity... | PubChem Bioassay (2008) BindingDB Entry DOI: 10.7270/Q2NC5ZHH | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM378885 (US10266537, Compound 93) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | PubMed | n/a | n/a | 143 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of human recombinant EPHA7 (613 to 909 residues) using [protein fragment, 39 aa] incubated for 40 mins in presence of [gamma... | Citation and Details BindingDB Entry DOI: 10.7270/Q2M90DC6 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50551644 (CHEMBL4745937) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem | Article PubMed | n/a | n/a | n/a | n/a | 3.26E+3 | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of human EPHA7 incubated for 30 mins by Kinobead based assay | Citation and Details Article DOI: 10.1016/j.ejmech.2020.112232 BindingDB Entry DOI: 10.7270/Q25H7KWP | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Mus musculus) | BDBM50551201 (CHEMBL4761556) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem | Article PubMed | n/a | n/a | >3.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Displacement of biotinylated ephrin-A1-Fc from mouse EphA7 Fc preincubated for 1 hr followed by ephrin-A1-FC addition and measured after 4 hrs by ELI... | Citation and Details Article DOI: 10.1016/j.ejmech.2020.112083 BindingDB Entry DOI: 10.7270/Q2X35233 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50563891 (CHEMBL4793380) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | PC cid PC sid UniChem | Article PubMed | n/a | n/a | 199 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese... | Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM2579 ((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE KEGG MMDB PC cid PC sid PDB UniChem Patents Similars | Article PubMed | n/a | n/a | 39.2 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Assay Description Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assay | Citation and Details Article DOI: 10.1016/j.bmc.2018.02.022 BindingDB Entry DOI: 10.7270/Q2DJ5KB8 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM13533 (1-[2-(4-methylphenyl)-5-tert-butyl-pyrazol-3-yl]-3...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL DrugBank MCE MMDB PC cid PC sid PDB UniChem Patents Similars | Article PubMed | n/a | n/a | <1.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
Northwestern University Curated by ChEMBL | Assay Description Concentration required to inhibit the phosphorylation of a 14-residue fragment of phospholipase C gamma 1 by Epidermal growth factor receptor from A4... | J Med Chem 62: 5298-5311 (2019) Article DOI: 10.1021/acs.jmedchem.9b00058 BindingDB Entry DOI: 10.7270/Q24170ZD | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50519662 (CHEMBL4438748) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem | Article PubMed | n/a | n/a | >1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA Curated by ChEMBL | Assay Description Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate measured after 40 mins in presence of [gamma33ATP] by ra... | J Med Chem 62: 10691-10710 (2019) Article DOI: 10.1021/acs.jmedchem.9b01143 BindingDB Entry DOI: 10.7270/Q2MC93FG | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM2579 ((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE KEGG MMDB PC cid PC sid PDB UniChem Patents Similars | Article PubMed | n/a | n/a | 56.3 | n/a | n/a | n/a | n/a | n/a | n/a |
University of Florida Curated by ChEMBL | Assay Description Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate by [gamma-33P]-ATP assay | Eur J Med Chem 161: 456-467 (2019) Article DOI: 10.1016/j.ejmech.2018.10.052 BindingDB Entry DOI: 10.7270/Q2W380MT | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50466038 (CHEMBL4281823) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem | Article PubMed | n/a | n/a | 190 | n/a | n/a | n/a | n/a | n/a | n/a |
Sichuan University/Collaborative Innovation Center of Biotherapy Curated by ChEMBL | Assay Description Inhibition of recombinant human EphA7 (613 to 909 residues) using KTFCGTPEYLAPE as substrate after 40 mins in presence of [gamma-33P]-ATP by scintill... | J Med Chem 61: 11398-11414 (2018) Article DOI: 10.1021/acs.jmedchem.8b01652 BindingDB Entry DOI: 10.7270/Q2377CDJ | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50345579 (5-((5-(4-((4-(2-hydroxyethyl)piperazin-1-yl)methyl...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid UniChem Similars | Article PubMed | n/a | n/a | 4.20 | n/a | n/a | n/a | n/a | n/a | n/a |
ARIAD Pharmaceuticals, Inc. Curated by ChEMBL | Assay Description Inhibition of human EPHA7 using poly[Glu:Tyr] peptide substrate by Hotspot assay | Bioorg Med Chem Lett 21: 3743-8 (2011) Article DOI: 10.1016/j.bmcl.2011.04.060 BindingDB Entry DOI: 10.7270/Q21G0MM8 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50299218 (8-(2-Methoxyphenyl)-1-methyl-7-(2'-methyl-5'-hydro...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | CHEMBL PC cid PC sid PDB UniChem Similars | Article PubMed | n/a | n/a | 1.12E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
University of Zurich Curated by ChEMBL | Assay Description Inhibition of EphA7 by [gamma33-P]ATP based assay | J Med Chem 52: 6433-46 (2009) Article DOI: 10.1021/jm9009444 BindingDB Entry DOI: 10.7270/Q2BZ663G | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50135286 (CHEMBL3745885) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE PC cid PC sid UniChem Patents Similars | Article PubMed | n/a | n/a | >1.00E+4 | n/a | n/a | n/a | n/a | n/a | n/a |
Icahn School of Medicine at Mount Sinai Curated by ChEMBL | Assay Description Inhibition of human EPHA7 using poly[Glu:Tyr] (4:1) as substrate | Bioorg Med Chem 24: 521-44 (2016) Article DOI: 10.1016/j.bmc.2015.11.045 BindingDB Entry DOI: 10.7270/Q24Q7WT8 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50244430 (9-(2,6-dimethylstyryl)-N-(4-(dimethylphosphoryl)ph...) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase CHEMBL MCE PC cid PC sid UniChem Similars | Article PubMed | n/a | n/a | >1.00E+3 | n/a | n/a | n/a | n/a | n/a | n/a |
ARIAD Pharmaceuticals, Inc. Curated by ChEMBL | Assay Description Inhibition of EphA1 | Bioorg Med Chem Lett 18: 4907-12 (2008) Article DOI: 10.1016/j.bmcl.2008.06.042 BindingDB Entry DOI: 10.7270/Q2H41R78 | |||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50605159 (CHEMBL5195469) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid PDB UniChem | Article PubMed | n/a | n/a | 162 | n/a | n/a | n/a | n/a | n/a | n/a |
TBA | Citation and Details Article DOI: 10.1021/acs.jmedchem.2c00308 BindingDB Entry DOI: 10.7270/Q2KP868W | ||||||||||||
More data for this Ligand-Target Pair | |||||||||||||
Ephrin type-A receptor 7 (Homo sapiens (Human)) | BDBM50271212 (CHEMBL3715238) | PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet | Purchase MCE PC cid PC sid UniChem Similars | Article PubMed | n/a | n/a | 665 | n/a | n/a | n/a | n/a | n/a | n/a |
WuXi AppTec Co., Ltd. Curated by ChEMBL | Assay Description Inhibition of recombinant GST-tagged human EphA7 cytoplasmic domain expressed in baculovirus expression system by FRET assay | J Med Chem 60: 8083-8102 (2017) Article DOI: 10.1021/acs.jmedchem.7b00843 BindingDB Entry DOI: 10.7270/Q2639S7K | |||||||||||
More data for this Ligand-Target Pair |