BindingDB PrimarySearch

null

SMILES: CC(C)(C)c1cc(NC(=O)Nc2ccc(Nc3ncnc4NCCCOc34)cc2)no1

InChI Key:

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 49 hits for monomerid = 50563891
Target/Host (Institution)	Ligand	Target/Host Links	Ligand Links	Trg + Lig Links	Ki nM	ΔG° kcal/mole	IC50 nM	Kd nM	EC50/IC50 nM	k_off s^-1	k_on M^-1s^-1	pH	Temp °C
Tyrosine-protein kinase Blk (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	Reactome pathway KEGG UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.91E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full length human BLK using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintilla...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase receptor UFO (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	708	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human Axl (473 to end residues) using KKSRGDYMTMQIG as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mast/stem cell growth factor receptor Kit (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	218	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human C-Kit using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillation count...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Discoidin domain-containing receptor 2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	55	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human DDR2 (467 to end residues) using KKSRGDYMTMQIG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sci...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Ephrin type-A receptor 3 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	552	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human EphA3 (578 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Ephrin type-B receptor 2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.09E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human EphB2 (560 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Fibroblast growth factor receptor 1 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	868	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human FGFR1 (456 to 765 residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by s...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Receptor-type tyrosine-protein kinase FLT3 [K633Q] (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	13	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human FLT3 (564 to end residues) using EAIYAAPFAKKK as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Macrophage colony-stimulating factor 1 receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	9	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human FMS (538 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sci...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Homeodomain-interacting protein kinase 4 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	KEGG UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	127	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human HIPK4 using RRRFRPASPLRGPPK as substrate after 40 mins by [gamma-33ATP] radiometric assay				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase ITK/TSK (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	338	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human ITK (352 to 617 residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assay				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase Lyn (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	122	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human Lyn using poly(Glu, Tyr) 4:1 as substrate after 40 mins in presence of [gamma-33ATP] by scintillation counting based ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
MAP kinase-interacting serine/threonine-protein kinase 2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	136	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human MNK2 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33ATP by scintillation count...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Serine/threonine-protein kinase Nek9 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	Reactome pathway KEGG UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.80E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human NEK9 (1 to 324 residues) using myelin basic protein as substrate measured after 40 mins in presence of [gamma33P]ATP ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase FRK (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	51	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human PTK5 (218 to end residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by s...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Macrophage-stimulating protein receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.26E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human Ron (983 to end residues) using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by s...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase 12 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	199	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human full length SAPK3 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scint...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase kinase kinase 7 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	484	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TAK1 (1 to 303 residues) using casein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillatio...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Angiopoietin-1 receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	408	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TIE2 (771 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma33P]ATP b...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
BDNF/NT-3 growth factors receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	68	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TRKB (455 to end residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma33P]ATP b...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
TRAF2 and NCK-interacting protein kinase (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt B.MOAD GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	221	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human TNIK (1 to 367 residues) using RLGRDKYKTLRQIRQ as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation c...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase kinase kinase 20 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB NCI pathway KEGG UniProtKB/SwissProt GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	19	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full-length human ZAK using MBP as substrate incubated for 40 mins in presence of [gamma33P]ATP by scintillation counting b...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Proto-oncogene tyrosine-protein kinase receptor Ret (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	9	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human RET V804L mutant using KKKVSRSGLYRSP as substrate incubated for 15 mins followed by Mg/ATP addition and measured afte...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Proto-oncogene tyrosine-protein kinase receptor Ret (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	15	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human RET V804M mutant using KKKVSRSGLYRSP as substrate incubated for 15 mins followed by Mg/ATP addition and measured afte...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Proto-oncogene tyrosine-protein kinase receptor Ret (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	10	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human RET using KKKSPGEYVNIEFG as substrate incubated for 15 mins followed by Mg/ATP addition and measured after 40 mins by...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Aurora kinase B (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.63E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full length human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in presence of [gamma-33ATP] by scintillati...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Serine/threonine-protein kinase B-raf (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	957	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full length human B-Raf (416 to end residues) using myelin basic protein substrate incubated for 40 mins in presence of [ga...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Cyclin-dependent kinase 4/G1/S-specific cyclin-D3 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD antibodypedia antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.11E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full length human CDK4/CyclinD3 using Rb fragment as substrate incubated for 40 mins in presence of [gamma-33ATP] by scinti...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Casein kinase I isoform delta (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt B.MOAD GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	509	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human CK1delta (1 to 294 residues) using KRRRALS(p)VASLPGL as substrate incubated for 40 mins in presence of [gamma-33ATP] ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
RAF proto-oncogene serine/threonine-protein kinase (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	232	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human C-Raf (306 to end residues) poly(Glu, Tyr) 4:1 as substrate incubated 40 mins in presence of [gamma-33ATP] by scintil...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Ephrin type-A receptor 2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	104	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human EphA2 (596 to 900 residues) using poly(Glu, Tyr) 4:1 as substrate incubated for 40 mins in presence of [gamma-33ATP] ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Ephrin type-A receptor 7 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	199	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human EphA7 (613 to 909 residues) using [protein fragment, 39 aa] as substrate incubated for 40 mins in prese...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Ephrin type-B receptor 1 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	388	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human EphB1 (564 to end residues) using KVEKIGEGTYGVVYK as substrate incubated for 40 mins in presence of [gamma-33ATP] by ...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Vascular endothelial growth factor receptor 1 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	8	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human FLT1 (783 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma-33ATP] by sc...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Vascular endothelial growth factor receptor 3 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	6	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human FLT4 (800 to end residues) using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of [gamma-33ATP] by s...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase HCK (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	87	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human HCK (230 to 497 residues) using KVEKIGEGTYGVVYK as substrate after 40 mins by [gamma-33ATP] radiometric assay				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Interleukin-1 receptor-associated kinase 1 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB KEGG UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	179	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human IRAK1 (194 to end residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assay				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Vascular endothelial growth factor receptor 2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	892	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human KDR (790 to end residues) using myelin basic protein as substrate after 40 mins by [gamma-33ATP] radiometric assay				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Tyrosine-protein kinase Mer (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	1.49E+3	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human MER (557 to 882 residues) using KKLNRTLSFAEPG as substrate incubated for 40 mins in presence of [gamma-33ATP by scint...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase kinase kinase kinase 5 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	NCI pathway KEGG UniProtKB/SwissProt GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	711	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human MAP4K5 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma-33ATP by scintillation cou...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Platelet-derived growth factor receptor beta (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB NCI pathway Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	686	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human PDGFRbeta (557 to end residues) using poly(Glu, Tyr) 4:1 as substrate measured after 40 mins in presence of [gamma33P]ATP by scin...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Platelet-derived growth factor receptor alpha (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB KEGG UniProtKB/SwissProt DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	262	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of human PDGFRalpha (550 to end residues) using poly(Glu, Tyr) 4:1 as substrate measured after 40 mins in presence of [gamma33P]ATP by sci...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase 11 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	50	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human full length SAPK2b using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scin...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Mitogen-activated protein kinase 13 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	214	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human full length SAPK4 using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP by scint...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Serine/threonine-protein kinase TAO2 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB UniProtKB/SwissProt antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	903	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TAO2 (1 to 320 residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP b...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
High affinity nerve growth factor receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB UniProtKB/SwissProt B.MOAD DrugBank antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	71	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TRKA (440 to end residues) using KKKSPGEYVNIEFG as substrate incubated for 40 mins in presence of [gamma33P]ATP by sc...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
NT-3 growth factor receptor (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB KEGG UniProtKB/SwissProt B.MOAD antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	20	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human TRKC (510 to end residues) using GEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of [gamma33P]ATP by sc...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Serine/threonine-protein kinase WNK3 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	494	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant human WNK3 (1 to 434 residues) using myelin basic protein as substrate incubated for 40 mins in presence of [gamma33P]ATP b...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair
Cyclin-T1/Cyclin-dependent kinase 9 (Homo sapiens (Human))	BDBM50563891 (CHEMBL4793380) Show SMILES Show InChI	PDB MMDB Reactome pathway KEGG UniProtKB/SwissProt B.MOAD DrugBank antibodypedia antibodypedia GoogleScholar AffyNet	PC cid PC sid UniChem	Article PubMed	n/a	n/a	833	n/a	n/a	n/a	n/a	n/a	n/a
TBA					Assay Description Inhibition of recombinant full length human CDK9/cyclinT1 using KTFCGTPEYLAPE as substrate incubated for 40 mins in presence of [gamma-33ATP] by scin...				Citation and Details Article DOI: 10.1016/j.ejmech.2017.09.018 BindingDB Entry DOI: 10.7270/Q270854P
TBA					More data for this Ligand-Target Pair