| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Interleukin-1 beta |
|---|
| Ligand | BDBM531337 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IL-1 Secretion Assa |
|---|
| IC50 | 1.30±n/a nM |
|---|
| Citation |  Farady, C; Gommermann, N; Janser, P; Mackay, A; Mattes, H; Smith, N; Solovay, CF; Stiefl, NJ; Vangrevelinghe, E; Velcicky, J; von Matt, A NLRP3 inflammasome inhibitors US Patent US11208399 Publication Date 12/28/2021 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Interleukin-1 beta |
|---|
| Name: | Interleukin-1 beta |
|---|
| Synonyms: | IL1B | IL1B_HUMAN | IL1F2 | Interleukin 1-beta | Interleukin-1 beta | hIL-1beta |
|---|
| Type: | Cytokine |
|---|
| Mol. Mass.: | 30734.47 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01584 |
|---|
| Residue: | 269 |
|---|
| Sequence: | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
|
|
|
|---|
| BDBM531337 |
|---|
| n/a |
|---|
| Name | BDBM531337 |
|---|
| Synonyms: | 3-Methyl-2-(6-(((1R,2R,5R)-8-methyl-8-azabicyclo[3.2.1]octan-2-yl)amino)pyridazin-3-yl)-5-(trifluoromethyl)phenol | US11208399, Example 85b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23F3N4O |
|---|
| Mol. Mass. | 392.418 |
|---|
| SMILES | CN1C2CCC1C(CC2)Nc1ccc(nn1)-c1c(C)cc(cc1O)C(F)(F)F |TLB:0:1:6.7.8:3.4,THB:9:6:1:3.4| |
|---|
| Structure | 
|
|---|
Search and Browse
