| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A2a |
|---|
| Ligand | BDBM551557 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Measurement of A2a Binding Affinity Using Radioligand Binding |
|---|
| IC50 | 0.500±n/a nM |
|---|
| Citation |  Larsen, MA; Ali, A; Cumming, J; DeMong, D; Deng, Q; Graham, TH; Hennessy, E; Hoover, AJ; Liu, P; Liu, K; Mansoor, UF; Pan, J; Plummer, CW; Sather, A; Swaminathan, U; Wang, H; Zhang, Y 9-substituted amino triazolo quinazoline derivatives as adenosine receptor antagonists, pharmaceutical compositions and their use US Patent US11312719 Publication Date 4/26/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A2a |
|---|
| Name: | Adenosine receptor A2a |
|---|
| Synonyms: | A2A adenosine receptor (hA2A) | AA2AR_HUMAN | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 44716.46 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P29274 |
|---|
| Residue: | 412 |
|---|
| Sequence: | MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
|
|
|
|---|
| BDBM551557 |
|---|
| n/a |
|---|
| Name | BDBM551557 |
|---|
| Synonyms: | (R or S)-7,9-difluoro-2-(1-(1-methyl-1H-pyrazol-4-yl) piperidin-3-yl)-[1,2,4]triazolo[1,5-c]quinazolin-5-amine | US11312719, Example 103 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18F2N8 |
|---|
| Mol. Mass. | 384.3859 |
|---|
| SMILES | Cn1cc(cn1)N1CCCC(C1)c1nc2c3cc(F)cc(F)c3nc(N)n2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
