| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
|---|
| Ligand | BDBM571437 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Protein-Protein Interaction Assay: BCL-2/Bad BH3 Peptide (BCL-2 Assay) |
|---|
| IC50 | >20000±n/a nM |
|---|
| Citation |  Thede, K; Mengel, A; Christ, C; Kuhnke, J; Johannes, SA; Buchgraber, P; Klar, U; Rauh, U; Kaulfuss, S; Fernandez-Montalvan, AE; Werbeck, N; Mönning, U; Nowak-Reppel, K; Wittrock, S; McKinney, D; Serrano-Wu, MH; Lemke, C; Fitzgerald, M; Nasveschuk, C; Lazarski, K; Ferrara, SJ; Furst, L; Wei, G; McCarren, PR; Harvey, RA Substituted macrocyclic indole derivatives US Patent US11440923 Publication Date 9/13/2022 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
|---|
| Name: | Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
|---|
| Synonyms: | BCL-2/Bad BH3 Peptide |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Apoptosis regulator Bcl-2 [1-211] |
|---|
| Synonyms: | BCL2 | BCL2_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23308.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415[1-211] |
|---|
| Residue: | 211 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
|
|
|
|---|
| Component 2 |
| Name: | Bcl2-associated agonist of cell death [103-127,M117N] |
|---|
| Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | cl2-associated agonist of cell death (BAD)(BH3) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 3088.39 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q92934[103-127,M117N] |
|---|
| Residue: | 25 |
|---|
| Sequence: | NLWAAQRYGRELRRNSDEFVDSFKK
|
|
|
|---|
| BDBM571437 |
|---|
| n/a |
|---|
| Name | BDBM571437 |
|---|
| Synonyms: | (rac)-2,3,15-trimethyl-7-[3-(naphthalen-1-yloxy)propyl]-2,10,11,12,13,15-hexahydropyrazolo[4′,3′:9,10][1,6]oxazacycloundecino[8,7,6-hi]indole-8-carboxylic Acid (Mixture of Stereoisomers) | US11440923, Example 1 | US11440923, Example 2 | US11440923, Example 3 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H35N3O4 |
|---|
| Mol. Mass. | 537.6487 |
|---|
| SMILES | CC1OCCCCn2c(C(O)=O)c(CCCOc3cccc4ccccc34)c3cccc(-c4c(C)n(C)nc14)c23 |
|---|
| Structure | 
|
|---|
Search and Browse
