Reaction Details |
| Report a problem with these data |
Target | Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
---|
Ligand | BDBM571459 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Protein-Protein Interaction Assay: BCL-2/Bad BH3 Peptide (BCL-2 Assay) |
---|
IC50 | >20000±n/a nM |
---|
Citation | Thede, K; Mengel, A; Christ, C; Kuhnke, J; Johannes, SA; Buchgraber, P; Klar, U; Rauh, U; Kaulfuss, S; Fernandez-Montalvan, AE; Werbeck, N; Mönning, U; Nowak-Reppel, K; Wittrock, S; McKinney, D; Serrano-Wu, MH; Lemke, C; Fitzgerald, M; Nasveschuk, C; Lazarski, K; Ferrara, SJ; Furst, L; Wei, G; McCarren, PR; Harvey, RA Substituted macrocyclic indole derivatives US Patent US11440923 Publication Date 9/13/2022 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
---|
Name: | Apoptosis regulator Bcl-2 [1-211]/Bad BH3 Peptide |
Synonyms: | BCL-2/Bad BH3 Peptide |
Type: | Protein |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Apoptosis regulator Bcl-2 [1-211] |
Synonyms: | BCL2 | BCL2_HUMAN |
Type: | Protein |
Mol. Mass.: | 23308.03 |
Organism: | Homo sapiens (Human) |
Description: | P10415[1-211] |
Residue: | 211 |
Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
|
|
|
Component 2 |
Name: | Bcl2-associated agonist of cell death [103-127,M117N] |
Synonyms: | BAD | BAD_HUMAN | BBC6 | BCL2L8 | cl2-associated agonist of cell death (BAD)(BH3) |
Type: | n/a |
Mol. Mass.: | 3088.39 |
Organism: | Homo sapiens (Human) |
Description: | Q92934[103-127,M117N] |
Residue: | 25 |
Sequence: | NLWAAQRYGRELRRNSDEFVDSFKK
|
|
|
BDBM571459 |
---|
n/a |
---|
Name | BDBM571459 |
Synonyms: | (+)-4-chloro-3-ethyl-7-{3-[(6-fluoronaphthalen-1-yl)oxy]propyl}-2-methyl-15-[2-(morpholin-4-yl)ethyl]-2,10,11,12,13,15-hexahydropyrazolo[4′,3′:9,10][1,6]oxazacycloundecino[8,7,6-hi]indole-8-carboxylic Acid—N-ethylethanamine (Enantiomer 1) | US11440923, Example 23 |
Type | Small organic molecule |
Emp. Form. | C39H44ClFN4O5 |
Mol. Mass. | 703.242 |
SMILES | CCc1c-2c(nn1C)C(CCN1CCOCC1)OCCCCn1c(C(O)=O)c(CCCOc3cccc4cc(F)ccc34)c3ccc(Cl)c-2c13 |
Structure |
|