Reaction Details |
| Report a problem with these data |
Target | Bromodomain-containing protein 9 [133-239] |
---|
Ligand | BDBM621666 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | BRD9 Bromodomain TR-FRET Competition Binding Assay |
---|
IC50 | <10±n/a nM |
---|
Citation | Zhou, Q; Bocker, M; Millan, DS; Chan, HM; Soares, L; Netherton, MR; Ruppel, SK; Yang, Z; Lowe, JT; Brucelle, F Methods and compounds for treating disorders US Patent US11773085 Publication Date 10/3/2023 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain-containing protein 9 [133-239] |
---|
Name: | Bromodomain-containing protein 9 [133-239] |
Synonyms: | BRD9 | BRD9_HUMAN | Bromodomain-containing protein 9 (BRD9)(133-239) |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 12383.34 |
Organism: | Homo sapiens (Human) |
Description: | aa 133-239 |
Residue: | 107 |
Sequence: | PAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVA
NEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
|
|
|
BDBM621666 |
---|
n/a |
---|
Name | BDBM621666 |
Synonyms: | N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-2,7-naphthyridin-4-yl)phenyl]methyl]-N-methylmethanesulfonamide | US11773085, Compound B38 |
Type | Small organic molecule |
Emp. Form. | C20H23N3O5S |
Mol. Mass. | 417.479 |
SMILES | COc1cc(cc(OC)c1CN(C)S(C)(=O)=O)-c1cn(C)c(=O)c2cnccc12 |
Structure |
|