| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 9 [133-239] |
|---|
| Ligand | BDBM621698 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | BRD9 Bromodomain TR-FRET Competition Binding Assay |
|---|
| IC50 | <10±n/a nM |
|---|
| Citation |  Zhou, Q; Bocker, M; Millan, DS; Chan, HM; Soares, L; Netherton, MR; Ruppel, SK; Yang, Z; Lowe, JT; Brucelle, F Methods and compounds for treating disorders US Patent US11773085 Publication Date 10/3/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 9 [133-239] |
|---|
| Name: | Bromodomain-containing protein 9 [133-239] |
|---|
| Synonyms: | BRD9 | BRD9_HUMAN | Bromodomain-containing protein 9 (BRD9)(133-239) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12383.34 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 133-239 |
|---|
| Residue: | 107 |
|---|
| Sequence: | PAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVA
NEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSK
|
|
|
|---|
| BDBM621698 |
|---|
| n/a |
|---|
| Name | BDBM621698 |
|---|
| Synonyms: | N-[[2,6-dimethoxy-4-(2-methyl-1-oxo-1,2-dihydro-2,7-naphthyridin-4-yl)phenyl]methyl]-6-[[2-(2,6-dioxopiperidin-3-yl)-1,3-dioxo-2,3-dihydro-1H-isoindol-4-yl]oxy]-N-methylhexanamide | US11773085, Compound D4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H39N5O9 |
|---|
| Mol. Mass. | 709.7444 |
|---|
| SMILES | COc1cc(cc(OC)c1CN(C)C(=O)CCCCCOc1cccc2C(=O)N(C3CCC(=O)NC3=O)C(=O)c12)-c1cn(C)c(=O)c2cnccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
