| Reaction Details |
|---|
 | Report a problem with these data |
| Target | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Ligand | BDBM363479 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Electrophysiology Assay |
|---|
| IC50 | 100.0±n/a nM |
|---|
| Citation |  Pasternak, A; Ding, F; Dong, S; Jiang, J; Tang, H; Gu, X; DeJesus, RK; Frie, J; Fu, Q; Suzuki, T; Pu, Z Inhibitors of the renal outer medullary potassium channel US Patent US9850245 Publication Date 12/26/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Name: | ATP-sensitive inward rectifier potassium channel 1 |
|---|
| Synonyms: | ATP-regulated potassium channel ROM-K | ATP-regulated potassium channel ROMK | ATP-sensitive inward rectifier potassium channel 1 | Egl nine homolog 1 | KCNJ1 | KCNJ1_HUMAN | Potassium channel (ATP modulatory) | Potassium inwardly-rectifying channel, subfamily J, member 1 | ROMK1 | Renal Outer Medullary Potassium (ROMK1) | The Renal Outer Medullary Potassium (ROMK) |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 44809.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_223460826 |
|---|
| Residue: | 391 |
|---|
| Sequence: | MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDVRARMKRGYDNPNFILSEVNETDDTKM
|
|
|
|---|
| BDBM363479 |
|---|
| n/a |
|---|
| Name | BDBM363479 |
|---|
| Synonyms: | (S)-4-(9-(2-(6-(1H-tetrazol-1- yl)pyridin-3-yl)-2-hydroxyethyl)- 1-oxa-4,9- diazaspiro[5.5]undecan-4- yl)furan-2(5H)-one | US9850245, Example 19B |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25N7O4 |
|---|
| Mol. Mass. | 427.457 |
|---|
| SMILES | O[C@H](CN1CCC2(CC1)CN(CCO2)C1=CC(=O)OC1)c1ccc(nc1)-n1cnnn1 |r,t:16| |
|---|
| Structure | 
|
|---|
Search and Browse
