Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cyclin-dependent kinase 5 activator 1 |
---|
Ligand | BDBM24654 |
---|
Substrate/Competitor | Histone H1 Peptide |
---|
Meas. Tech. | CDK5/p35 Assay |
---|
IC50 | 18±n/a nM |
---|
Citation | Wyatt, PG; Woodhead, AJ; Berdini, V; Boulstridge, JA; Carr, MG; Cross, DM; Davis, DJ; Devine, LA; Early, TR; Feltell, RE; Lewis, EJ; McMenamin, RL; Navarro, EF; O'Brien, MA; O'Reilly, M; Reule, M; Saxty, G; Seavers, LC; Smith, DM; Squires, MS; Trewartha, G; Walker, MT; Woolford, AJ Identification of N-(4-piperidinyl)-4-(2,6-dichlorobenzoylamino)-1H-pyrazole-3-carboxamide (AT7519), a novel cyclin dependent kinase inhibitor using fragment-based X-ray crystallography and structure based drug design. J Med Chem51:4986-99 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cyclin-dependent kinase 5 activator 1 |
---|
Name: | Cyclin-dependent kinase 5 activator 1 |
Synonyms: | CDK5/p35 | Cyclin-Dependent Kinase 5 (CDK5) | Cyclin-dependent kinase 5 regulatory subunit 1 | Cyclin-dependent kinase 5/CDK5 activator 1 |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Cyclin-dependent kinase 5 |
Synonyms: | CDK5 | CDK5_HUMAN | CDKN5 | Cell division protein kinase 5 | Cyclin-dependent kinase 5 (CDK5/ p25) | Cyclin-dependent kinase 5 (CDK5/p35) | Cyclin-dependent-like kinase 5 | Cyclin-dependent-like kinase 5 (CDK5) | PSSALRE | Serine/threonine-protein kinase PSSALRE | Tau protein kinase II catalytic subunit |
Type: | Enzyme Subunit |
Mol. Mass.: | 33308.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 292 |
Sequence: | MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
|
|
|
Component 2 |
Name: | Cyclin-dependent kinase 5 activator 1 |
Synonyms: | CD5R1_HUMAN | CDK5R | CDK5R1 | Cyclin-Dependent Kinase 5 Activator 1, p35 | Cyclin-dependent kinase 5 (CDK5/p25) | Cyclin-dependent kinase 5 regulatory subunit 1 | NCK5A | TPKII regulatory subunit | p35 |
Type: | Enzyme Subunit |
Mol. Mass.: | 34077.43 |
Organism: | Homo sapiens (Human) |
Description: | Q15078 |
Residue: | 307 |
Sequence: | MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR
|
|
|
BDBM24654 |
---|
Histone H1 Peptide |
---|
Name: | Histone H1 Peptide |
Synonyms: | biotinylated peptide |
Type: | Peptide |
Mol. Mass.: | 1585.01 |
Organism: | n/a |
Description: | n/a |
Residue: | 14 |
Sequence: | |