| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peroxisome proliferator-activated receptor alpha |
|---|
| Ligand | BDBM29891 |
|---|
| Substrate/Competitor | BDBM28662 |
|---|
| Meas. Tech. | Scintillation Proximity Assay (Ki) and Cell-Based Transcription Assay (EC50) |
|---|
| pH | 7.1±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| Ki | 7900±n/a nM |
|---|
| EC50 | >100000±n/a nM |
|---|
| Citation |  Connors, RV; Wang, Z; Harrison, M; Zhang, A; Wanska, M; Hiscock, S; Fox, B; Dore, M; Labelle, M; Sudom, A; Johnstone, S; Liu, J; Walker, NP; Chai, A; Siegler, K; Li, Y; Coward, P Identification of a PPARdelta agonist with partial agonistic activity on PPARgamma. Bioorg Med Chem Lett19:3550-4 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Peroxisome proliferator-activated receptor alpha |
|---|
| Name: | Peroxisome proliferator-activated receptor alpha |
|---|
| Synonyms: | NR1C1 | Nuclear receptor subfamily 1 group C member 1 | PPAR | PPAR alpha/gamma | PPAR-alpha | PPARA | PPARA_HUMAN | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor alpha (PPAR alpha) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 52222.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q07869 |
|---|
| Residue: | 468 |
|---|
| Sequence: | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
|
|---|
| BDBM29891 |
|---|
| BDBM28662 |
|---|
| Name | BDBM29891 |
|---|
| Synonyms: | alkynyl ether, 33 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H28F3NO5S |
|---|
| Mol. Mass. | 571.607 |
|---|
| SMILES | CCC#CCOc1cc(COc2ccc(cn2)C(F)(F)F)ccc1Sc1ccc(OCC(O)=O)c2CCCCc12 |
|---|
| Structure | 
|
|---|
Search and Browse
