| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protein tyrosine phosphatase type IVA 3 |
|---|
| Ligand | BDBM396097 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Biochemical Evaluation |
|---|
| IC50 | 18.0±14 nM |
|---|
| Citation |  Lazo, JS; Sharlow, ER; McQueeney, KE; Wipf, P; Salamoun, JM Inhibitors of PTP4A3 for the treatment of cancer US Patent US10308663 Publication Date 6/4/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protein tyrosine phosphatase type IVA 3 |
|---|
| Name: | Protein tyrosine phosphatase type IVA 3 |
|---|
| Synonyms: | PRL3 | PTP4A3 | Protein-tyrosine phosphatase 4A3 | TP4A3_HUMAN |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19546.22 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1461022 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM
|
|
|
|---|
| BDBM396097 |
|---|
| n/a |
|---|
| Name | BDBM396097 |
|---|
| Synonyms: | US10308663, JMS-631-053 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H8N2O2S |
|---|
| Mol. Mass. | 256.28 |
|---|
| SMILES | N=C1c2sc(cc2C(=O)NC1=O)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
