Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
---|
Ligand | BDBM31943 |
---|
Substrate/Competitor | BDBM8737 |
---|
Meas. Tech. | Enzymatic Inhibition Assay |
---|
pH | 8±n/a |
---|
Temperature | 298.15±n/a K |
---|
Comments | Not active @ 50 uM. |
---|
Citation | He, L; Zhang, L; Liu, X; Li, X; Zheng, M; Li, H; Yu, K; Chen, K; Shen, X; Jiang, H; Liu, H Discovering potent inhibitors against the beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Helicobacter pylori: structure-based design, synthesis, bioassay, and crystal structure determination. J Med Chem52:2465-81 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
---|
Name: | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
Synonyms: | (3R)-hydroxymyristoyl ACP dehydrase | (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase | FABZ_HELPY | beta-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) | fabZ |
Type: | Lyase |
Mol. Mass.: | 18198.05 |
Organism: | Helicobacter pylori (Campylobacter pylori) |
Description: | HpfabZ is expressed and purified from E. coli. |
Residue: | 159 |
Sequence: | MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRIIELQANKKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQTGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERD
|
|
|
BDBM31943 |
---|
BDBM8737 |
---|
Name | BDBM31943 |
Synonyms: | 1,3-thiazolidin-5-ylidene derivative, 4g |
Type | Small organic molecule |
Emp. Form. | C25H20BrClN2O5S |
Mol. Mass. | 575.859 |
SMILES | COCCN1C(=O)\C(S\C1=N\c1ccccc1Br)=C/c1ccc(o1)-c1ccc(Cl)c(c1)C(=O)OC |
Structure |
|