Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM1259 |
---|
Substrate/Competitor | Peptide substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 5.2±n/a nM |
---|
Citation | deSolms, SJ; Giuliani, EA; Guare, JP; Vacca, JP; Sanders, WM; Graham, SL; Wiggins, JM; Darke, PL; Sigal, IS; Zugay, JA Design and synthesis of HIV protease inhibitors. Variations of the carboxy terminus of the HIV protease inhibitor L-682,679. J Med Chem34:2852-7 (1991) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Tandem linked enzyme construct |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM1259 |
---|
Peptide substrate |
---|
Name: | Peptide substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 4618.57 |
Organism: | n/a |
Description: | n/a |
Residue: | 43 |
Sequence: | NH2-Val-Ser-Gln-Asn-(beta-napthylalanine)-Pro-Val-Ile-Gln-OH
|
|
|