Reaction Details |
| Report a problem with these data |
Target | Dual specificity protein phosphatase 3 |
---|
Ligand | BDBM50092807 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1688536 |
---|
IC50 | 13000±n/a nM |
---|
Citation | Yamazaki, H; Kanno, SI; Abdjul, DB; Namikoshi, M A bromopyrrole-containing diterpene alkaloid from the Okinawan marine sponge Agelas nakamurai activates the insulin pathway in Huh-7 human hepatoma cells by inhibiting protein tyrosine phosphatase 1B. Bioorg Med Chem Lett27:2207-2209 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dual specificity protein phosphatase 3 |
---|
Name: | Dual specificity protein phosphatase 3 |
Synonyms: | DUS3_HUMAN | DUSP3 | Dual specificity protein phosphatase (VHR) | Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR |
Type: | Hydrolase |
Mol. Mass.: | 20480.58 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 185 |
Sequence: | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
|
|
|
BDBM50092807 |
---|
n/a |
---|
Name | BDBM50092807 |
Synonyms: | CHEMBL3586411 |
Type | Small organic molecule |
Emp. Form. | C31H42BrN6O2 |
Mol. Mass. | 610.608 |
SMILES | [H][C@@]12CCC=C(COC(=O)c3cc(Br)c[nH]3)[C@]1(C)CC[C@H](C)[C@@]2(C)CC\C(C)=C\C[n+]1cn(C)c2ncnc(N)c12 |r,t:4| |
Structure |
|