Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50261828 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_1696472 |
---|
IC50 | 1.000000±n/a nM |
---|
Citation | Barberis, C; Moorcroft, N; Pribish, J; Tserlin, E; Gross, A; Czekaj, M; Barrague, M; Erdman, P; Majid, T; Batchelor, J; Levit, M; Hebert, A; Shen, L; Moreno-Mazza, S; Wang, A Discovery of N-substituted 7-azaindoles as Pan-PIM kinase inhibitors - Lead series identification - Part II. Bioorg Med Chem Lett27:4735-4740 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50261828 |
---|
n/a |
---|
Name | BDBM50261828 |
Synonyms: | CHEMBL4095220 |
Type | Small organic molecule |
Emp. Form. | C14H15Cl2IN4O |
Mol. Mass. | 453.106 |
SMILES | NC1CCCC(C1)n1c(I)c(Cl)c2c(Cl)cc(nc12)C(N)=O |
Structure |
|