| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Outer membrane protein MIP |
|---|
| Ligand | BDBM50263405 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1697921 (CHEMBL4048811) |
|---|
| Ki | 598±n/a nM |
|---|
| Citation |  Pomplun, S; Sippel, C; Hähle, A; Tay, D; Shima, K; Klages, A; Ünal, CM; Rieß, B; Toh, HT; Hansen, G; Yoon, HS; Bracher, A; Preiser, P; Rupp, J; Steinert, M; Hausch, F Chemogenomic Profiling of Human and Microbial FK506-Binding Proteins. J Med Chem61:3660-3673 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Outer membrane protein MIP |
|---|
| Name: | Outer membrane protein MIP |
|---|
| Synonyms: | MIP_LEGPN | Macrophage infectivity potentiator | PPIase | Peptidyl-prolyl cis-trans isomerase | Rotamase | mip |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 24869.94 |
|---|
| Organism: | Legionella pneumophila |
|---|
| Description: | ChEMBL_701873 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MKMKLVTAAVMGLAMSTAMAATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAK
GMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPG
VVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIP
GWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
|
|
|
|---|
| BDBM50263405 |
|---|
| n/a |
|---|
| Name | BDBM50263405 |
|---|
| Synonyms: | CHEMBL4062637 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25Cl2N3O3S |
|---|
| Mol. Mass. | 482.423 |
|---|
| SMILES | [H][C@]12CCC[C@]([H])(N1S(=O)(=O)c1cc(Cl)cc(Cl)c1)C(=O)N(Cc1ccccn1)C[C@@H]2CC |r,TLB:31:30:7:2.3.4,20:19:7:2.3.4,THB:22:21:7:2.3.4| |
|---|
| Structure | 
|
|---|
Search and Browse
