| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Somatostatin receptor type 2 |
|---|
| Ligand | BDBM50451391 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1745056 (CHEMBL4179566) |
|---|
| IC50 | 0.200000±n/a nM |
|---|
| Citation |  Banno, Y; Sasaki, S; Kamata, M; Kunitomo, J; Miyamoto, Y; Abe, H; Taya, N; Oi, S; Watanabe, M; Urushibara, T; Hazama, M; Niwa, SI; Miyamoto, S; Horinouchi, A; Kuroshima, KI; Amano, N; Matsumoto, SI; Matsunaga, S Design and synthesis of a novel series of orally active, selective somatostatin receptor 2 agonists for the treatment of type 2 diabetes. Bioorg Med Chem25:5995-6006 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Somatostatin receptor type 2 |
|---|
| Name: | Somatostatin receptor type 2 |
|---|
| Synonyms: | SOMATOSTATIN SST2 | SRIF-1 | SS-2-R | SS2-R | SS2R | SSR2_HUMAN | SSTR2 | Somatostatin receptor type 2 (SSTR2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41344.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30874 |
|---|
| Residue: | 369 |
|---|
| Sequence: | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
|
|
|
|---|
| BDBM50451391 |
|---|
| n/a |
|---|
| Name | BDBM50451391 |
|---|
| Synonyms: | CHEMBL4212088 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H41FN6O4 |
|---|
| Mol. Mass. | 628.7362 |
|---|
| SMILES | CCOc1ccc(CN(C)C)cc1NC(=O)[C@H](NC(=O)N1CCN(C(=O)C1)c1ccc(F)cc1C)[C@@H](C)c1c[nH]c2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
