Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50021494 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_145293 |
---|
Ki | 63±n/a nM |
---|
Citation | Portoghese, PS; Larson, DL; Sayre, LM; Yim, CB; Ronsisvalle, G; Tam, SW; Takemori, AE Opioid agonist and antagonist bivalent ligands. The relationship between spacer length and selectivity at multiple opioid receptors. J Med Chem29:1855-61 (1986) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50021494 |
---|
n/a |
---|
Name | BDBM50021494 |
Synonyms: | 1N-[10,17-dihydroxy-4-methyl-(13R,14R,17S)-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7(18),8,10-trien-14-yl]acetamide | CHEMBL3350139 |
Type | Small organic molecule |
Emp. Form. | C19H24N2O4 |
Mol. Mass. | 344.4049 |
SMILES | [H][C@@]12Oc3c4c(C[C@H]5N(C)CC[C@@]14[C@@]5(O)CC[C@H]2NC(C)=O)ccc3O |THB:9:8:13:4.5.6| |
Structure |
|