Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50461109 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1770714 (CHEMBL4222826) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Cui, G; Jin, J; Chen, H; Cao, R; Chen, X; Xu, B Synthesis and biological evaluation of pyrimidine derivatives as novel human Pin1 inhibitors. Bioorg Med Chem26:2186-2197 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50461109 |
---|
n/a |
---|
Name | BDBM50461109 |
Synonyms: | CHEMBL4227088 |
Type | Small organic molecule |
Emp. Form. | C17H10N4O4 |
Mol. Mass. | 334.2857 |
SMILES | [O-][N+](=O)c1cnc(nc1Oc1cccc2ocnc12)-c1ccccc1 |
Structure |
|