Reaction Details |
| Report a problem with these data |
Target | Cytochrome c oxidase subunit 2 |
---|
Ligand | BDBM50462393 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1774825 (CHEMBL4231817) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Pippione, AC; Carnovale, IM; Bonanni, D; Sini, M; Goyal, P; Marini, E; Pors, K; Adinolfi, S; Zonari, D; Festuccia, C; Wahlgren, WY; Friemann, R; Bagnati, R; Boschi, D; Oliaro-Bosso, S; Lolli, ML Potent and selective aldo-keto reductase 1C3 (AKR1C3) inhibitors based on the benzoisoxazole moiety: application of a bioisosteric scaffold hopping approach to flufenamic acid. Eur J Med Chem150:930-945 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cytochrome c oxidase subunit 2 |
---|
Name: | Cytochrome c oxidase subunit 2 |
Synonyms: | COII | COX2 | COX2_HUMAN | COXII | MT-CO2 | MTCO2 |
Type: | PROTEIN |
Mol. Mass.: | 25555.66 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_530099 |
Residue: | 227 |
Sequence: | MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
|
|
|
BDBM50462393 |
---|
n/a |
---|
Name | BDBM50462393 |
Synonyms: | CHEMBL4249427 |
Type | Small organic molecule |
Emp. Form. | C13H9N3O4 |
Mol. Mass. | 271.2283 |
SMILES | Oc1noc2cccc(Nc3cccc(c3)[N+]([O-])=O)c12 |
Structure |
|