Reaction Details |
| Report a problem with these data |
Target | Sigma intracellular receptor 2 |
---|
Ligand | BDBM50464853 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1783007 (CHEMBL4254524) |
---|
Ki | 32±n/a nM |
---|
Citation | Temme, L; Frehland, B; Schepmann, D; Robaa, D; Sippl, W; Wünsch, B Hydroxymethyl bioisosteres of phenolic GluN2B-selective NMDA receptor antagonists: Design, synthesis and pharmacological evaluation. Eur J Med Chem144:672-681 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma intracellular receptor 2 |
---|
Name: | Sigma intracellular receptor 2 |
Synonyms: | S2r | SGMR2_RAT | Sigma intracellular receptor 2 | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97 |
Type: | Protein |
Mol. Mass.: | 20953.88 |
Organism: | Rattus norvegicus (Rat) |
Description: | Q5U3Y7 |
Residue: | 176 |
Sequence: | MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLFCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILF
EDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKFEEKRKKK
|
|
|
BDBM50464853 |
---|
n/a |
---|
Name | BDBM50464853 |
Synonyms: | CHEMBL4286654 |
Type | Small organic molecule |
Emp. Form. | C20H25NO |
Mol. Mass. | 295.4186 |
SMILES | Oc1ccc2CCC(CCc2c1)NCCCc1ccccc1 |
Structure |
|