Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Low molecular weight protein-tyrosine phosphatase A |
---|
Ligand | BDBM50466478 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1793230 (CHEMBL4265149) |
---|
IC50 | 2900±n/a nM |
---|
Citation | Sens, L; de Souza, ACA; Pacheco, LA; Menegatti, ACO; Mori, M; Mascarello, A; Nunes, RJ; Terenzi, H Synthetic thiosemicarbazones as a new class of Mycobacterium tuberculosis protein tyrosine phosphatase A inhibitors. Bioorg Med Chem26:5742-5750 (2018) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Low molecular weight protein-tyrosine phosphatase A |
---|
Name: | Low molecular weight protein-tyrosine phosphatase A |
Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
Type: | Hydrolase |
Mol. Mass.: | 17891.84 |
Organism: | Mycobacterium tuberculosis |
Description: | n/a |
Residue: | 163 |
Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
BDBM50466478 |
---|
n/a |
---|
Name | BDBM50466478 |
Synonyms: | CHEMBL4288744 |
Type | Small organic molecule |
Emp. Form. | C23H15ClF3N3OS |
Mol. Mass. | 473.898 |
SMILES | FC(F)(F)c1ccc(Cl)c(c1)-c1ccc(\C=N\NC(=S)Nc2cccc3ccccc23)o1 |
Structure |
|