| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Ligand | BDBM50466483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1793230 (CHEMBL4265149) |
|---|
| IC50 | 23700±n/a nM |
|---|
| Citation |  Sens, L; de Souza, ACA; Pacheco, LA; Menegatti, ACO; Mori, M; Mascarello, A; Nunes, RJ; Terenzi, H Synthetic thiosemicarbazones as a new class of Mycobacterium tuberculosis protein tyrosine phosphatase A inhibitors. Bioorg Med Chem26:5742-5750 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Low molecular weight protein-tyrosine phosphatase A |
|---|
| Name: | Low molecular weight protein-tyrosine phosphatase A |
|---|
| Synonyms: | PTPA_MYCTU | PTPase | Probable low molecular weight protein-tyrosine-phosphatase | Protein Tyrosine Phosphatase PTPA | mptpA | ptpA |
|---|
| Type: | Hydrolase |
|---|
| Mol. Mass.: | 17891.84 |
|---|
| Organism: | Mycobacterium tuberculosis |
|---|
| Description: | n/a |
|---|
| Residue: | 163 |
|---|
| Sequence: | MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAG
VLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTH
ALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
|
|
|
|---|
| BDBM50466483 |
|---|
| n/a |
|---|
| Name | BDBM50466483 |
|---|
| Synonyms: | CHEMBL4287324 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17N3S |
|---|
| Mol. Mass. | 355.455 |
|---|
| SMILES | S=C(N\N=C\c1ccc2ccccc2c1)Nc1cccc2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
