| Reaction Details |
|---|
 | Report a problem with these data |
| Target | HTH-type quorum-sensing regulator RhlR |
|---|
| Ligand | BDBM50470115 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1691975 (CHEMBL4042624) |
|---|
| IC50 | 2030±n/a nM |
|---|
| Citation |  Fong, J; Yuan, M; Jakobsen, TH; Mortensen, KT; Delos Santos, MM; Chua, SL; Yang, L; Tan, CH; Nielsen, TE; Givskov, M Disulfide Bond-Containing Ajoene Analogues As Novel Quorum Sensing Inhibitors of Pseudomonas aeruginosa. J Med Chem60:215-227 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| HTH-type quorum-sensing regulator RhlR |
|---|
| Name: | HTH-type quorum-sensing regulator RhlR |
|---|
| Synonyms: | Elastase modulator | RHLR_PSEAE | Regulatory protein RhlR | lasM | rhlR | vsmR | vsmR |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 27579.79 |
|---|
| Organism: | Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG12228) |
|---|
| Description: | ChEMBL_108034 |
|---|
| Residue: | 241 |
|---|
| Sequence: | MRNDGGFLLWWDGLRSEMQPIHDSQGVFAVLEKEVRRLGFDYYAYGVRHTIPFTRPKTEV
HGTYPKAWLERYQMQNYGAVDPAILNGLRSSEMVVWSDSLFDQSRMLWNEARDWGLCVGA
TLPIRAPNNLLSVLSVARDQQNISSFEREEIRLRLRCMIELLTQKLTDLEHPMLMSNPVC
LSHREREILQWTADGKSSGEIAIILSISESTVNFHHKNIQKKFDAPNKTLAAAYAAALGL
I
|
|
|
|---|
| BDBM50470115 |
|---|
| n/a |
|---|
| Name | BDBM50470115 |
|---|
| Synonyms: | CHEMBL4098007 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H9NS3 |
|---|
| Mol. Mass. | 239.38 |
|---|
| SMILES | C=CCSSc1nc2ccccc2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
