Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50224283 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_54725 (CHEMBL668338) |
---|
IC50 | 1659587±n/a nM |
---|
Citation | Dunn, WJ; Hopfinger, AJ; Catana, C; Duraiswami, C Solution of the conformation and alignment tensors for the binding of trimethoprim and its analogs to dihydrofolate reductase: 3D-quantitative structure-activity relationship study using molecular shape analysis, 3-way partial least-squares regression, and 3-way factor analysis. J Med Chem39:4825-32 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | Dihydrofolate reductase (F31V) | dfrA17 |
Type: | n/a |
Mol. Mass.: | 17532.46 |
Organism: | Escherichia coli |
Description: | n/a |
Residue: | 157 |
Sequence: | MKISLISAVSESGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYA
VVSKNGISSSNENVLVFPSIENALKELSKVTDHVYVSGGGQIYNSLIEKADIIHLSTVHV
EVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG
|
|
|
BDBM50224283 |
---|
n/a |
---|
Name | BDBM50224283 |
Synonyms: | CHEMBL283279 |
Type | Small organic molecule |
Emp. Form. | C11H12N4O2 |
Mol. Mass. | 232.2386 |
SMILES | Nc1ncc(Cc2cc(O)cc(O)c2)c(N)n1 |
Structure |
|