Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Similar to alpha-tubulin isoform 1 |
---|
Ligand | BDBM50472344 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_211318 (CHEMBL818978) |
---|
IC50 | 370±n/a nM |
---|
Citation | Zhang, SX; Bastow, KF; Tachibana, Y; Kuo, SC; Hamel, E; Mauger, A; Narayanan, VL; Lee, KH Antitumor agents. 196. Substituted 2-thienyl-1,8-naphthyridin-4-ones: their synthesis, cytotoxicity, and inhibition of tubulin polymerization. J Med Chem42:4081-7 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Similar to alpha-tubulin isoform 1 |
---|
Name: | Similar to alpha-tubulin isoform 1 |
Synonyms: | Similar to alpha-tubulin isoform 1 |
Type: | PROTEIN |
Mol. Mass.: | 10383.05 |
Organism: | Bos taurus |
Description: | ChEMBL_104716 |
Residue: | 99 |
Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
BDBM50472344 |
---|
n/a |
---|
Name | BDBM50472344 |
Synonyms: | CHEMBL132896 |
Type | Small organic molecule |
Emp. Form. | C17H12N2OS |
Mol. Mass. | 292.355 |
SMILES | Cc1ccc2c(O)cc(nc2n1)-c1csc2ccccc12 |
Structure |
|