Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50474153 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_145450 (CHEMBL752039) |
---|
Ki | 13±n/a nM |
---|
Citation | Takayama, H; Ishikawa, H; Kurihara, M; Kitajima, M; Aimi, N; Ponglux, D; Koyama, F; Matsumoto, K; Moriyama, T; Yamamoto, LT; Watanabe, K; Murayama, T; Horie, S Studies on the synthesis and opioid agonistic activities of mitragynine-related indole alkaloids: discovery of opioid agonists structurally different from other opioid ligands. J Med Chem45:1949-56 (2002) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50474153 |
---|
n/a |
---|
Name | BDBM50474153 |
Synonyms: | CHEMBL61630 |
Type | Small organic molecule |
Emp. Form. | C23H30N2O5 |
Mol. Mass. | 414.4947 |
SMILES | [H][C@@]12C[C@@H]([C@H](CC)CN1CC[C@@]1(O)C2=Nc2cccc(OC)c12)C(=C/OC)\C(=O)OC |t:15| |
Structure |
|