Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM50161649 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_460519 (CHEMBL926599) |
---|
EC50 | 6.3±n/a nM |
---|
Citation | Smith, BM; Smith, JM; Tsai, JH; Schultz, JA; Gilson, CA; Estrada, SA; Chen, RR; Park, DM; Prieto, EB; Gallardo, CS; Sengupta, D; Dosa, PI; Covel, JA; Ren, A; Webb, RR; Beeley, NR; Martin, M; Morgan, M; Espitia, S; Saldana, HR; Bjenning, C; Whelan, KT; Grottick, AJ; Menzaghi, F; Thomsen, WJ Discovery and structure-activity relationship of (1R)-8-chloro-2,3,4,5-tetrahydro-1-methyl-1H-3-benzazepine (Lorcaserin), a selective serotonin 5-HT2C receptor agonist for the treatment of obesity. J Med Chem51:305-13 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM50161649 |
---|
n/a |
---|
Name | BDBM50161649 |
Synonyms: | (1R,S)-8-trifluoromethyl-2,3,4,5-tetrahydro-1-methyl-1H-3-benzazepine | 1-Methyl-8-trifluoromethyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine | CHEMBL178124 |
Type | Small organic molecule |
Emp. Form. | C12H14F3N |
Mol. Mass. | 229.2415 |
SMILES | CC1CNCCc2ccc(cc12)C(F)(F)F |
Structure |
|