| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50450813 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_541098 (CHEMBL1034081) |
|---|
| IC50 | 380±n/a nM |
|---|
| Citation |  Boojamra, CG; Parrish, JP; Sperandio, D; Gao, Y; Petrakovsky, OV; Lee, SK; Markevitch, DY; Vela, JE; Laflamme, G; Chen, JM; Ray, AS; Barron, AC; Sparacino, ML; Desai, MC; Kim, CU; Cihlar, T; Mackman, RL Design, synthesis, and anti-HIV activity of 4'-modified carbocyclic nucleoside phosphonate reverse transcriptase inhibitors. Bioorg Med Chem17:1739-46 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50450813 |
|---|
| n/a |
|---|
| Name | BDBM50450813 |
|---|
| Synonyms: | Atripla | CHEBI:63625 | GS-1275 | PMP-A | Tenofovir | Truvada |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C9H14N5O4P |
|---|
| Mol. Mass. | 287.2123 |
|---|
| SMILES | C[C@H](Cn1cnc2c(N)ncnc12)OCP(O)(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
