| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM4685 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_544291 (CHEMBL1020429) |
|---|
| Ki | 0.000015±n/a nM |
|---|
| Citation |  Hazen, R; Harvey, R; Ferris, R; Craig, C; Yates, P; Griffin, P; Miller, J; Kaldor, I; Ray, J; Samano, V; Furfine, E; Spaltenstein, A; Hale, M; Tung, R; St Clair, M; Hanlon, M; Boone, L In vitro antiviral activity of the novel, tyrosyl-based human immunodeficiency virus (HIV) type 1 protease inhibitor brecanavir (GW640385) in combination with other antiretrovirals and against a panel of protease inhibitor-resistant HIV. Antimicrob Agents Chemother51:3147-54 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM4685 |
|---|
| n/a |
|---|
| Name | BDBM4685 |
|---|
| Synonyms: | (3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S,3R)-4-[2H-1,3-benzodioxole-5-(2-methylpropyl)sulfonamido]-3-hydroxy-1-{4-[(2-methyl-1,3-thiazol-4-yl)methoxy]phenyl}butan-2-yl]carbamate | CHEMBL206031 | GW0385 | [3H]GW0385 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H41N3O10S2 |
|---|
| Mol. Mass. | 703.823 |
|---|
| SMILES | [H][C@]12OCC[C@@]1([H])[C@H](CO2)OC(=O)N[C@@H](Cc1ccc(OCc2csc(C)n2)cc1)[C@H](O)CN(CC(C)C)S(=O)(=O)c1ccc2OCOc2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
