| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50479982 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_544292 (CHEMBL1020430) |
|---|
| Ki | 0.008±n/a nM |
|---|
| Citation |  Hazen, R; Harvey, R; Ferris, R; Craig, C; Yates, P; Griffin, P; Miller, J; Kaldor, I; Ray, J; Samano, V; Furfine, E; Spaltenstein, A; Hale, M; Tung, R; St Clair, M; Hanlon, M; Boone, L In vitro antiviral activity of the novel, tyrosyl-based human immunodeficiency virus (HIV) type 1 protease inhibitor brecanavir (GW640385) in combination with other antiretrovirals and against a panel of protease inhibitor-resistant HIV. Antimicrob Agents Chemother51:3147-54 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50479982 |
|---|
| n/a |
|---|
| Name | BDBM50479982 |
|---|
| Synonyms: | Aptivus | CHEBI:63628 | Tipranavir | U-140690 | US10806794, Compound Tipranavir |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33F3N2O5S |
|---|
| Mol. Mass. | 602.664 |
|---|
| SMILES | CCC[C@@]1(CCc2ccccc2)CC(O)=C([C@H](CC)c2cccc(NS(=O)(=O)c3ccc(cn3)C(F)(F)F)c2)C(=O)O1 |t:15| |
|---|
| Structure | 
|
|---|
Search and Browse
