| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50481433 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_609663 (CHEMBL1067226) |
|---|
| IC50 | 15±n/a nM |
|---|
| Citation |  Bonini, C; Chiummiento, L; De Bonis, M; Di Blasio, N; Funicello, M; Lupattelli, P; Pandolfo, R; Tramutola, F; Berti, F Synthesis of new thienyl ring containing HIV-1 protease inhibitors: promising preliminary pharmacological evaluation against recombinant HIV-1 proteases. J Med Chem53:1451-7 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50481433 |
|---|
| n/a |
|---|
| Name | BDBM50481433 |
|---|
| Synonyms: | CHEMBL591933 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H45N3O4S |
|---|
| Mol. Mass. | 591.804 |
|---|
| SMILES | [H][C@@]12CCCC[C@]1([H])CN(C[C@@H](O)[C@H](Cc1cc3ccccc3s1)NC(=O)c1cccc(O)c1C)[C@@H](C2)C(=O)NC(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
