| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50482144 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_629799 (CHEMBL1115617) |
|---|
| IC50 | 1900±n/a nM |
|---|
| Citation |  Mackman, RL; Ray, AS; Hui, HC; Zhang, L; Birkus, G; Boojamra, CG; Desai, MC; Douglas, JL; Gao, Y; Grant, D; Laflamme, G; Lin, KY; Markevitch, DY; Mishra, R; McDermott, M; Pakdaman, R; Petrakovsky, OV; Vela, JE; Cihlar, T Discovery of GS-9131: Design, synthesis and optimization of amidate prodrugs of the novel nucleoside phosphonate HIV reverse transcriptase (RT) inhibitor GS-9148. Bioorg Med Chem18:3606-17 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50482144 |
|---|
| n/a |
|---|
| Name | BDBM50482144 |
|---|
| Synonyms: | CHEMBL1098407 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H13FN5O11P3 |
|---|
| Mol. Mass. | 491.1568 |
|---|
| SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](OCP(O)(=O)OP(O)(=O)OP(O)(O)=O)C=C1F |r,c:29| |
|---|
| Structure | 
|
|---|
Search and Browse
