| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50021581 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_666886 (CHEMBL1262283) |
|---|
| IC50 | 13±n/a nM |
|---|
| Citation |  Garvey, EP; Johns, BA; Gartland, MJ; Foster, SA; Miller, WH; Ferris, RG; Hazen, RJ; Underwood, MR; Boros, EE; Thompson, JB; Weatherhead, JG; Koble, CS; Allen, SH; Schaller, LT; Sherrill, RG; Yoshinaga, T; Kobayashi, M; Wakasa-Morimoto, C; Miki, S; Nakahara, K; Noshi, T; Sato, A; Fujiwara, T The naphthyridinone GSK364735 is a novel, potent human immunodeficiency virus type 1 integrase inhibitor and antiretroviral. Antimicrob Agents Chemother52:901-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50021581 |
|---|
| n/a |
|---|
| Name | BDBM50021581 |
|---|
| Synonyms: | CHEMBL414850 | L-870810 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19FN4O4S |
|---|
| Mol. Mass. | 430.453 |
|---|
| SMILES | O\C(=N/Cc1ccc(F)cc1)c1nc(N2CCCCS2(=O)=O)c2cccnc2c1O |
|---|
| Structure | 
|
|---|
Search and Browse
