Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50183273 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_666886 (CHEMBL1262283) |
---|
IC50 | 11±n/a nM |
---|
Citation | Garvey, EP; Johns, BA; Gartland, MJ; Foster, SA; Miller, WH; Ferris, RG; Hazen, RJ; Underwood, MR; Boros, EE; Thompson, JB; Weatherhead, JG; Koble, CS; Allen, SH; Schaller, LT; Sherrill, RG; Yoshinaga, T; Kobayashi, M; Wakasa-Morimoto, C; Miki, S; Nakahara, K; Noshi, T; Sato, A; Fujiwara, T The naphthyridinone GSK364735 is a novel, potent human immunodeficiency virus type 1 integrase inhibitor and antiretroviral. Antimicrob Agents Chemother52:901-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50183273 |
---|
n/a |
---|
Name | BDBM50183273 |
Synonyms: | (S)-6-(3-chloro-2-fluorobenzyl)-1-(1-hydroxy-3-methylbutan-2-yl)-7-methoxy-4-oxo-1,4-dihydroquinoline-3-carboxylic acid | 6-(3-Chloro-2-fluorobenzyl)-1-((2S)-1-hydroxy-3-methylbutan-2-yl)-7-methoxy-4-oxo-1,4-dihydroquinoline-3-carboxylic acid | 6-(3-chloro-2-fluorobenzyl)-1-[(1S)-1-(hydroxymethyl)-2-methylpropyl]-7-methoxy-4-oxo-1,4-dihydroquinoline-3-carboxylic acid | CHEMBL204656 | ELVITEGRAVIR |
Type | Small organic molecule |
Emp. Form. | C23H23ClFNO5 |
Mol. Mass. | 447.884 |
SMILES | COc1cc2n(cc(C(O)=O)c(=O)c2cc1Cc1cccc(Cl)c1F)[C@H](CO)C(C)C |r| |
Structure |
|