Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50485192 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_822365 (CHEMBL2038743) |
---|
IC50 | 450±n/a nM |
---|
Citation | Gu, SX; Li, ZM; Ma, XD; Yang, SQ; He, QQ; Chen, FE; De Clercq, E; Balzarini, J; Pannecouque, C Chiral resolution, absolute configuration assignment and biological activity of racemic diarylpyrimidine CH(OH)-DAPY as potent nonnucleoside HIV-1 reverse transcriptase inhibitors. Eur J Med Chem53:229-34 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50485192 |
---|
n/a |
---|
Name | BDBM50485192 |
Synonyms: | CHEMBL1817673 |
Type | Small organic molecule |
Emp. Form. | C18H13ClN4O |
Mol. Mass. | 336.775 |
SMILES | OC(c1ccnc(Nc2ccc(cc2)C#N)n1)c1ccccc1Cl |
Structure |
|