Reaction Details |
| Report a problem with these data |
Target | Mas-related G-protein coupled receptor member X1 |
---|
Ligand | BDBM50497458 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1436305 (CHEMBL3388386) |
---|
EC50 | 1259±n/a nM |
---|
Citation | Hin, N; Alt, J; Zimmermann, SC; Delahanty, G; Ferraris, DV; Rojas, C; Li, F; Liu, Q; Dong, X; Slusher, BS; Tsukamoto, T Peptidomimetics of Arg-Phe-NH2 as small molecule agonists of Mas-related gene C (MrgC) receptors. Bioorg Med Chem22:5831-7 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mas-related G-protein coupled receptor member X1 |
---|
Name: | Mas-related G-protein coupled receptor member X1 |
Synonyms: | MRGX1_MOUSE | Mas-related G-protein coupled receptor member C11 | Mas-related G-protein coupled receptor member X1 | Mrgc11 | Mrgprc11 | Mrgprx1 | Sensory neuron-specific G-protein coupled receptor 1 |
Type: | PROTEIN |
Mol. Mass.: | 36822.23 |
Organism: | Mus musculus |
Description: | ChEMBL_109490 |
Residue: | 322 |
Sequence: | MDPTISSHDTESTPLNETGHPNCTPILTLSFLVLITTLVGLAGNTIVLWLLGFRMRRKAI
SVYILNLALADSFFLCCHFIDSLLRIIDFYGLYAHKLSKDILGNAAIIPYISGLSILSAI
STERCLCVLWPIWYHCHRPRNMSAIICALIWVLSFLMGILDWFSGFLGETHHHLWKNVDF
IITAFLIFLFMLLSGSSLALLLRILCGPRRKPLSRLYVTIALTVMVYLICGLPLGLYLFL
LYWFGVHLHYPFCHIYQVTAVLSCVNSSANPIIYFLVGSFRQHRKHRSLKRVLKRALEDT
PEEDEYTDSHLHKTTEISESRY
|
|
|
BDBM50497458 |
---|
n/a |
---|
Name | BDBM50497458 |
Synonyms: | CHEMBL3343994 |
Type | Small organic molecule |
Emp. Form. | C19H24N6O2 |
Mol. Mass. | 368.4329 |
SMILES | N[C@H](Cc1ccc(NC(N)=N)cc1)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
Structure |
|