| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mas-related G-protein coupled receptor member X1 |
|---|
| Ligand | BDBM50497458 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1436304 (CHEMBL3388385) |
|---|
| EC50 | 631±n/a nM |
|---|
| Citation |  Hin, N; Alt, J; Zimmermann, SC; Delahanty, G; Ferraris, DV; Rojas, C; Li, F; Liu, Q; Dong, X; Slusher, BS; Tsukamoto, T Peptidomimetics of Arg-Phe-NH2 as small molecule agonists of Mas-related gene C (MrgC) receptors. Bioorg Med Chem22:5831-7 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mas-related G-protein coupled receptor member X1 |
|---|
| Name: | Mas-related G-protein coupled receptor member X1 |
|---|
| Synonyms: | MRGX1_RAT | Mas-related G-protein coupled receptor member X1 | Mrgc | Mrgprc | Mrgprc11 | Mrgprx1 | Sensory neuron-specific G-protein coupled receptor 1 | Snsr | Snsr1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 37091.92 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_109489 |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDPTISSLSTESTTLNKTGHPSCRPILTLSFLVPIITLLGLAGNTIVLWLLGFRMRRKAI
SVYVLNLSLADSFFLCCHFIDSLMRIMNFYGIYAHKLSKEILGNAAIIPYISGLSILSAI
STERCLSVLWPIWYHCHRPRNMSAIICVLIWVLSFLMGILDWFFSGFLGETHHHLWKNVD
FIVTAFLIFLFMLLFGSSLALLVRILCGSRRKPLSRLYVTISLTVMVYLICGLPLGLYLF
LLYWFGIHLHYPFCHIYQVTVLLSCVNSSANPIIYFLVGSFRHRKKHRSLKMVLKRALEE
TPEEDEYTDSHVQKPTEISERRC
|
|
|
|---|
| BDBM50497458 |
|---|
| n/a |
|---|
| Name | BDBM50497458 |
|---|
| Synonyms: | CHEMBL3343994 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24N6O2 |
|---|
| Mol. Mass. | 368.4329 |
|---|
| SMILES | N[C@H](Cc1ccc(NC(N)=N)cc1)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
