Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Chymotrypsinogen A |
---|
Ligand | BDBM23563 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_216470 (CHEMBL818540) |
---|
Ki | 340±n/a nM |
---|
Citation | Pochet, L; Doucet, C; Schynts, M; Thierry, N; Boggetto, N; Pirotte, B; Jiang, KY; Masereel, B; de Tullio, P; Delarge, J; Reboud-Ravaux, M Esters and amides of 6-(chloromethyl)-2-oxo-2H-1-benzopyran-3-carboxylic acid as inhibitors of alpha-chymotrypsin: significance of the"aromatic" nature of the novel ester-type coumarin for strong inhibitory activity. J Med Chem39:2579-85 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Chymotrypsinogen A |
---|
Name: | Chymotrypsinogen A |
Synonyms: | Alpha-chymotrypsin | CTRA_BOVIN | Chymotrypsin A | Chymotrypsin A chain A | Chymotrypsin A chain B | Chymotrypsin A chain C | Chymotrypsinogen A | alpha-Chymotrypsin (α-Chymotrypsin) |
Type: | Serine protease |
Mol. Mass.: | 25670.88 |
Organism: | Bos taurus (bovine) |
Description: | n/a |
Residue: | 245 |
Sequence: | CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
TLAAN
|
|
|
BDBM23563 |
---|
n/a |
---|
Name | BDBM23563 |
Synonyms: | 3-Carboxylate-coumarin deriv., 3 | CHEMBL13357 | phenyl 6-(chloromethyl)-2-oxo-2H-chromene-3-carboxylate |
Type | Small organic molecule |
Emp. Form. | C17H11ClO4 |
Mol. Mass. | 314.72 |
SMILES | ClCc1ccc2oc(=O)c(cc2c1)C(=O)Oc1ccccc1 |
Structure |
|