| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Ligand | BDBM50502707 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1808268 (CHEMBL4307627) |
|---|
| IC50 | 23482±n/a nM |
|---|
| Citation |  Watkins, SM; Ghose, D; Blain, JM; Grote, DL; Luan, CH; Clare, M; Meganathan, R; Horn, JR; Hagen, TJ Antibacterial activity of 2-amino-4-hydroxypyrimidine-5-carboxylates and binding to Burkholderia pseudomallei 2-C-methyl-d-erythritol-2,4-cyclodiphosphate synthase. Bioorg Med Chem Lett29:0 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Name: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
|---|
| Synonyms: | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase | 4.6.1.12 | ISPF_SALTY | MECDP-synthase | MECPP-synthase | MECPS | ispF |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16899.38 |
|---|
| Organism: | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
|---|
| Description: | ChEMBL_119647 |
|---|
| Residue: | 159 |
|---|
| Sequence: | MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDEVNVKATTTEKLGFTGRGEGIACEAVALLMKAAK
|
|
|
|---|
| BDBM50502707 |
|---|
| n/a |
|---|
| Name | BDBM50502707 |
|---|
| Synonyms: | CHEMBL4458954 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12N4O3 |
|---|
| Mol. Mass. | 308.2915 |
|---|
| SMILES | OC(=O)c1cnc(Nc2ccc(cc2)-c2ccncc2)nc1O |
|---|
| Structure | 
|
|---|
Search and Browse
