| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase pim-2 |
|---|
| Ligand | BDBM50517431 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1869080 (CHEMBL4370146) |
|---|
| IC50 | 0.110000±n/a nM |
|---|
| Citation |  Wang, HL; Andrews, KL; Booker, SK; Canon, J; Cee, VJ; Chavez, F; Chen, Y; Eastwood, H; Guerrero, N; Herberich, B; Hickman, D; Lanman, BA; Laszlo, J; Lee, MR; Lipford, JR; Mattson, B; Mohr, C; Nguyen, Y; Norman, MH; Pettus, LH; Powers, D; Reed, AB; Rex, K; Sastri, C; Tamayo, N; Wang, P; Winston, JT; Wu, B; Wu, Q; Wu, T; Wurz, RP; Xu, Y; Zhou, Y; Tasker, AS Discovery of ( R)-8-(6-Methyl-4-oxo-1,4,5,6-tetrahydropyrrolo[3,4- b]pyrrol-2-yl)-3-(1-methylcyclopropyl)-2-((1-methylcyclopropyl)amino)quinazolin-4(3 H)-one, a Potent and Selective Pim-1/2 Kinase Inhibitor for Hematological Malignancies. J Med Chem62:1523-1540 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase pim-2 |
|---|
| Name: | Serine/threonine-protein kinase pim-2 |
|---|
| Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 34185.93 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9P1W9 |
|---|
| Residue: | 311 |
|---|
| Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
|---|
| BDBM50517431 |
|---|
| n/a |
|---|
| Name | BDBM50517431 |
|---|
| Synonyms: | CHEMBL4471849 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H27N7O2 |
|---|
| Mol. Mass. | 457.5276 |
|---|
| SMILES | CC(c1cn(C)cn1)n1c(NC2(C)CC2)nc2c(cccc2c1=O)-c1cc2C(=O)N[C@H](C)c2[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
