Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Proteasome subunit beta type-2 |
---|
Ligand | BDBM50517633 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1869379 (CHEMBL4370445) |
---|
IC50 | 13±n/a nM |
---|
Citation | Xin, BT; Huber, EM; de Bruin, G; Heinemeyer, W; Maurits, E; Espinal, C; Du, Y; Janssens, M; Weyburne, ES; Kisselev, AF; Florea, BI; Driessen, C; van der Marel, GA; Groll, M; Overkleeft, HS Structure-Based Design of Inhibitors Selective for Human Proteasome ?2c or ?2i Subunits. J Med Chem62:1626-1642 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-2 |
---|
Name: | Proteasome subunit beta type-2 |
Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
Type: | PROTEIN |
Mol. Mass.: | 22837.53 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1294233 |
Residue: | 201 |
Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
BDBM50517633 |
---|
n/a |
---|
Name | BDBM50517633 |
Synonyms: | CHEMBL4471150 |
Type | Small organic molecule |
Emp. Form. | C37H51N7O5 |
Mol. Mass. | 673.8447 |
SMILES | CC(C)[C@H](NC(=O)[C@H](Cc1ccc(CN)cc1)NC(=O)[C@H](Cc1ccccc1)N=[N+]=[N-])C(=O)N[C@@H](CCC1CCCCC1)C(=O)[C@@]1(C)CO1 |r| |
Structure |
|