Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM50060033 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_212168 (CHEMBL819016) |
---|
Ki | 140±n/a nM |
---|
Citation | Renatus, M; Bode, W; Huber, R; Stürzebecher, J; Stubbs, MT Structural and functional analyses of benzamidine-based inhibitors in complex with trypsin: implications for the inhibition of factor Xa, tPA, and urokinase. J Med Chem41:5445-56 (1999) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM50060033 |
---|
n/a |
---|
Name | BDBM50060033 |
Synonyms: | 3-[3-(4-Methyl-piperidin-1-yl)-2-(naphthalene-2-sulfonylamino)-3-oxo-propyl]-benzamidine | CHEMBL97597 |
Type | Small organic molecule |
Emp. Form. | C26H30N4O3S |
Mol. Mass. | 478.606 |
SMILES | CC1CCN(CC1)C(=O)C(Cc1cccc(c1)C(N)=N)NS(=O)(=O)c1ccc2ccccc2c1 |
Structure |
|