| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50521600 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1884838 (CHEMBL4386420) |
|---|
| EC50 | >10000±n/a nM |
|---|
| Citation |  Barrett, SD; Holt, MC; Kramer, JB; Germain, B; Ho, CS; Ciske, FL; Kornilov, A; Colombo, JM; Uzieblo, A; O'Malley, JP; Owen, TA; Stein, AJ; Morano, MI Difluoromethylene at the ?-Lactam ?-Position Improves 11-Deoxy-8-aza-PGE J Med Chem62:4731-4741 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50521600 |
|---|
| n/a |
|---|
| Name | BDBM50521600 |
|---|
| Synonyms: | CHEMBL4558749 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H33NO4 |
|---|
| Mol. Mass. | 363.491 |
|---|
| SMILES | CCC#CC[C@H](C)[C@H](O)\C=C\[C@H]1CCC(=O)N1CCCCCCC(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
