Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50521968 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1885883 (CHEMBL4387465) |
---|
IC50 | 850±n/a nM |
---|
Citation | Gao, P; Cheng, X; Sun, L; Song, S; Álvarez, M; Luczkowiak, J; Pannecouque, C; De Clercq, E; Menéndez-Arias, L; Zhan, P; Liu, X Design, synthesis and biological evaluation of 3-hydroxyquinazoline-2,4(1H,3H)-diones as dual inhibitors of HIV-1 reverse transcriptase-associated RNase H and integrase. Bioorg Med Chem27:3836-3845 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50521968 |
---|
n/a |
---|
Name | BDBM50521968 |
Synonyms: | CHEMBL4452475 |
Type | Small organic molecule |
Emp. Form. | C18H13N3O5S |
Mol. Mass. | 383.378 |
SMILES | On1c(=O)[nH]c2ccc(NS(=O)(=O)c3ccc4ccccc4c3)cc2c1=O |
Structure |
|