| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50062551 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1885880 (CHEMBL4387462) |
|---|
| IC50 | 0.500000±n/a nM |
|---|
| Citation |  Gao, P; Cheng, X; Sun, L; Song, S; Álvarez, M; Luczkowiak, J; Pannecouque, C; De Clercq, E; Menéndez-Arias, L; Zhan, P; Liu, X Design, synthesis and biological evaluation of 3-hydroxyquinazoline-2,4(1H,3H)-diones as dual inhibitors of HIV-1 reverse transcriptase-associated RNase H and integrase. Bioorg Med Chem27:3836-3845 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50062551 |
|---|
| n/a |
|---|
| Name | BDBM50062551 |
|---|
| Synonyms: | CHEBI:76010 | Dolutegravir | GSK1349572 | S-349572 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H19F2N3O5 |
|---|
| Mol. Mass. | 419.3788 |
|---|
| SMILES | [H][C@]12Cn3cc(C(=O)NCc4ccc(F)cc4F)c(=O)c(O)c3C(=O)N1[C@H](C)CCO2 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
