| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Protease |
|---|
| Ligand | BDBM50523560 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1890717 (CHEMBL4392471) |
|---|
| IC50 | 4.0±n/a nM |
|---|
| Citation |  A M Subbaiah, M; Mandlekar, S; Desikan, S; Ramar, T; Subramani, L; Annadurai, M; Desai, SD; Sinha, S; Jenkins, SM; Krystal, MR; Subramanian, M; Sridhar, S; Padmanabhan, S; Bhutani, P; Arla, R; Singh, S; Sinha, J; Thakur, M; Kadow, JF; Meanwell, NA Design, Synthesis, and Pharmacokinetic Evaluation of Phosphate and Amino Acid Ester Prodrugs for Improving the Oral Bioavailability of the HIV-1 Protease Inhibitor Atazanavir. J Med Chem62:3553-3574 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Protease |
|---|
| Name: | Protease |
|---|
| Synonyms: | n/a |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 10904.79 |
|---|
| Organism: | Human immunodeficiency virus 1 (HIV-1) |
|---|
| Description: | Q9YQ12 |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWQRPFVTIKIEGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50523560 |
|---|
| n/a |
|---|
| Name | BDBM50523560 |
|---|
| Synonyms: | CHEMBL4300203 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H61N7O8 |
|---|
| Mol. Mass. | 803.9865 |
|---|
| SMILES | COC(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)[C@H](CN(Cc1ccc(cc1)-c1ccccn1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)OC(=O)[C@@H](N)C(C)C)C(C)(C)C |r| |
|---|
| Structure | 
|
|---|
Search and Browse
